PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G21470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 472aa    MW: 50435.2 Da    PI: 5.2589
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G21470.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.82.7e-91764692373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalkl..fsevsP 89 
                      ++lL++cA+a++++d++l+q++L+ l+++a  dgd++qRl+a f+ AL +r +r  ++ +ka+++  ++  +    ++++++a++l  f +++P
  ORUFI07G21470.1  76 EQLLVHCANAIEANDATLTQQILWVLNNIAPADGDSNQRLTAAFLCALVSRASR--TGACKAVTAAVADAVEsaalHVHRFTAVELasFIDLTP 167
                      79***************************************************9..44454443333322221234666666666689****** PP

             GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefn 179
                      +++f++ +aN aI+eaveg   vHi+D++ ++++Q p+L++ La R+egpp lR+T+ + + s         +ee+g +L +fA++ +++++f+
  ORUFI07G21470.1 168 WHRFGYTAANAAIVEAVEGFPVVHIVDLSTTHCMQIPTLIDMLAGRAEGPPILRLTVADVAPSApppaLDMPYEELGAKLVNFARSRNMSMDFR 261
                      *********************************************************9886666787777789********************* PP

             GRAS 180 vl.......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.........erdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                      v+       +++ +++l++++L  + gEal+Vn+++ lh+++de++ + s          r+ +Lk ++ l P++vvvv+++ad ++++ + r+
  ORUFI07G21470.1 262 VVptspadaLTSLVDQLRVQQLVSDGGEALVVNCHMLLHTVPDETAGSVSlttaqppvsLRTMLLKSLRALDPTLVVVVDEDADFTAGDVVGRL 355
                      **887666555566677777777777****************887665555445566657899******************************* PP

             GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                        a+++ +  +d++++ lp+ se+r+++E+e +g++++nv+a+eg er+er+e  ++W +r+++aGF++++++e+aa ++k++l+ ++  g+ +
  ORUFI07G21470.1 356 RAAFNFLWIPYDAVDTFLPKGSEQRRWYEAE-VGWKVENVLAQEGVERVERQEDRARWGQRMRAAGFRAAAFGEEAAGEVKAMLNDHA-AGWGM 447
                      *******************************.********************************************************.88999 PP

             GRAS 352 eeesgslvlgWkdrpLvsvSaW 373
                      + e++ lvl+Wk++++v++SaW
  ORUFI07G21470.1 448 KREDDDLVLTWKGHNVVFASAW 469
                      9********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.4649451IPR005202Transcription factor GRAS
PfamPF035149.2E-8976469IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MQFTHTAPPP PPLHPNGHGL GLGLYLDVGA TRGGGGARPW SSSSSTTTLG GSGYFPSSAA  60
ASKISLGNLN STGCMEQLLV HCANAIEAND ATLTQQILWV LNNIAPADGD SNQRLTAAFL  120
CALVSRASRT GACKAVTAAV ADAVESAALH VHRFTAVELA SFIDLTPWHR FGYTAANAAI  180
VEAVEGFPVV HIVDLSTTHC MQIPTLIDML AGRAEGPPIL RLTVADVAPS APPPALDMPY  240
EELGAKLVNF ARSRNMSMDF RVVPTSPADA LTSLVDQLRV QQLVSDGGEA LVVNCHMLLH  300
TVPDETAGSV SLTTAQPPVS LRTMLLKSLR ALDPTLVVVV DEDADFTAGD VVGRLRAAFN  360
FLWIPYDAVD TFLPKGSEQR RWYEAEVGWK VENVLAQEGV ERVERQEDRA RWGQRMRAAG  420
FRAAAFGEEA AGEVKAMLND HAAGWGMKRE DDDLVLTWKG HNVVFASAWA PS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-16774696374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0037500.0AP003750.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1174_G05.
GenBankAP0051490.0AP005149.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBb0005G07.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645421.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-162SCL32_ARATH; Scarecrow-like protein 32
TrEMBLI1QBT60.0I1QBT6_ORYGL; Uncharacterized protein
STRINGORGLA07G0157800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-151GRAS family protein